SCOPe 2.05: Domain d3cswd_: 3csw D:

Lineage for d3cswd_ (3csw D:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.0: automated matches [191499] (1 protein)
   not a true family

6. Protein automated matches [190815] (10 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [188420] (1 PDB entry)

8. Domain d3cswd_: 3csw D: [173442]
   automated match to d1a3ga_
   complexed with cit, cl, mpd, plp, unl

Details for d3cswd_

PDB Entry: 3csw, 2.15 Å

PDB Description: crystal structure of a putative branched-chain amino acid aminotransferase (tm0831) from thermotoga maritima at 2.15 a resolution

PDB Compounds: (D:) Putative branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3cswd_:

Sequence; same for both SEQRES and ATOM records:

>d3cswd_ e.17.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
hvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffn
lplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisn
vrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkli
tpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrln
ehsffeeepgpvtatlmenfepfvlnleenwvgi

Timeline for d3cswd_:

• d3cswd_ first appeared in SCOPe 2.01
  
• d3cswd_ appears in SCOPe 2.04
  
• d3cswd_ is called d3cswd1 in SCOPe 2.06
  
• d3cswd_ appears in the current release, SCOPe 2.08, called d3cswd1