Lineage for d3cswd_ (3csw D:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1693973Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1693974Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1694057Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1694058Protein automated matches [190815] (9 species)
    not a true protein
  7. 1694081Species Thermotoga maritima [TaxId:243274] [188420] (1 PDB entry)
  8. 1694085Domain d3cswd_: 3csw D: [173442]
    automated match to d1a3ga_
    complexed with cit, cl, mpd, plp, unl

Details for d3cswd_

PDB Entry: 3csw (more details), 2.15 Å

PDB Description: crystal structure of a putative branched-chain amino acid aminotransferase (tm0831) from thermotoga maritima at 2.15 a resolution
PDB Compounds: (D:) Putative branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3cswd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cswd_ e.17.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 243274]}
hvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffn
lplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisn
vrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkli
tpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrln
ehsffeeepgpvtatlmenfepfvlnleenwvgi

SCOPe Domain Coordinates for d3cswd_:

Click to download the PDB-style file with coordinates for d3cswd_.
(The format of our PDB-style files is described here.)

Timeline for d3cswd_: