Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily) 2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8 |
Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) |
Family e.17.1.0: automated matches [191499] (1 protein) not a true family |
Protein automated matches [190815] (3 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [188420] (1 PDB entry) |
Domain d3cswd_: 3csw D: [173442] automated match to d1a3ga_ complexed with cit, cl, mpd, plp, unl |
PDB Entry: 3csw (more details), 2.15 Å
SCOPe Domain Sequences for d3cswd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cswd_ e.17.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 243274]} hvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffn lplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisn vrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkli tpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrln ehsffeeepgpvtatlmenfepfvlnleenwvgi
Timeline for d3cswd_: