Lineage for d3cswc_ (3csw C:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953348Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1953349Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1953446Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1953447Protein automated matches [190815] (10 species)
    not a true protein
  7. 1953483Species Thermotoga maritima [TaxId:243274] [188420] (1 PDB entry)
  8. 1953486Domain d3cswc_: 3csw C: [173441]
    automated match to d1a3ga_
    complexed with cit, cl, mpd, plp, unl

Details for d3cswc_

PDB Entry: 3csw (more details), 2.15 Å

PDB Description: crystal structure of a putative branched-chain amino acid aminotransferase (tm0831) from thermotoga maritima at 2.15 a resolution
PDB Compounds: (C:) Putative branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3cswc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cswc_ e.17.1.0 (C:) automated matches {Thermotoga maritima [TaxId: 243274]}
hhvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadff
nlplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkis
nvrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkl
itpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrl
nehsffeeepgpvtatlmenfepfvlnleenwvgi

SCOPe Domain Coordinates for d3cswc_:

Click to download the PDB-style file with coordinates for d3cswc_.
(The format of our PDB-style files is described here.)

Timeline for d3cswc_: