Lineage for d3cswb1 (3csw B:1-273)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573253Species Thermotoga maritima [TaxId:243274] [188420] (1 PDB entry)
  8. 2573255Domain d3cswb1: 3csw B:1-273 [173440]
    Other proteins in same PDB: d3cswa2, d3cswb2, d3cswc2, d3cswd2
    automated match to d1a3ga_
    complexed with cit, cl, mpd, plp, unl

Details for d3cswb1

PDB Entry: 3csw (more details), 2.15 Å

PDB Description: crystal structure of a putative branched-chain amino acid aminotransferase (tm0831) from thermotoga maritima at 2.15 a resolution
PDB Compounds: (B:) Putative branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3cswb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cswb1 e.17.1.0 (B:1-273) automated matches {Thermotoga maritima [TaxId: 243274]}
vliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffnl
plslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisnv
rripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegklit
psldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrlne
hsffeeepgpvtatlmenfepfvlnleenwvgi

SCOPe Domain Coordinates for d3cswb1:

Click to download the PDB-style file with coordinates for d3cswb1.
(The format of our PDB-style files is described here.)

Timeline for d3cswb1: