Lineage for d3cswa_ (3csw A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1056766Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 1056767Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 1056844Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 1056845Protein automated matches [190815] (3 species)
    not a true protein
  7. 1056846Species Thermotoga maritima [TaxId:243274] [188420] (1 PDB entry)
  8. 1056847Domain d3cswa_: 3csw A: [173439]
    automated match to d1a3ga_
    complexed with cit, cl, mpd, plp, unl

Details for d3cswa_

PDB Entry: 3csw (more details), 2.15 Å

PDB Description: crystal structure of a putative branched-chain amino acid aminotransferase (tm0831) from thermotoga maritima at 2.15 a resolution
PDB Compounds: (A:) Putative branched-chain-amino-acid aminotransferase

SCOPe Domain Sequences for d3cswa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cswa_ e.17.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
hvliwwrgkfrradeisldfslfekslqgavyetlrtysrapfaaykhytrlkrsadffn
lplslsfdeftkvlkagadefkqevrikvylfpdsgevlfvfsplnipdletgvevkisn
vrripdlstppalkitgrtdivlarreivdcydvillglngqvcegsfsnvflvkegkli
tpsldsgildgitrenviklaksleipveervvwvwelfeademflthtsagvvpvrrln
ehsffeeepgpvtatlmenfepfvlnleenwvgi

SCOPe Domain Coordinates for d3cswa_:

Click to download the PDB-style file with coordinates for d3cswa_.
(The format of our PDB-style files is described here.)

Timeline for d3cswa_: