SCOPe 2.05: Domain d3cqqb_: 3cqq B:

Lineage for d3cqqb_ (3cqq B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (71 PDB entries)

8. Domain d3cqqb_: 3cqq B: [173418]
   automated match to d1hl4a_
   complexed with ace, zn

Details for d3cqqb_

PDB Entry: 3cqq, 1.9 Å

PDB Description: Human SOD1 G85R Variant, Structure II

PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3cqqb_:

Sequence, based on SEQRES records:

>d3cqqb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records):

>d3cqqb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvhekadnagsrlac
gvigiaq

Timeline for d3cqqb_:

• d3cqqb_ first appeared in SCOPe 2.01
  
• d3cqqb_ appears in SCOPe 2.04
  
• d3cqqb_ appears in SCOPe 2.06
  
• d3cqqb_ appears in the current release, SCOPe 2.08