Lineage for d3cqlb_ (3cql B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632228Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
    automatically mapped to Pfam PF00182
  6. 1632236Protein automated matches [190455] (6 species)
    not a true protein
  7. 1632254Species Papaya (Carica papaya) [TaxId:3649] [188512] (1 PDB entry)
  8. 1632256Domain d3cqlb_: 3cql B: [173412]
    automated match to d1cnsa_
    complexed with gol, nag, ndg, so4

Details for d3cqlb_

PDB Entry: 3cql (more details), 1.5 Å

PDB Description: crystal structure of gh family 19 chitinase from carica papaya
PDB Compounds: (B:) Endochitinase

SCOPe Domain Sequences for d3cqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cqlb_ d.2.1.1 (B:) automated matches {Papaya (Carica papaya) [TaxId: 3649]}
giekiisrsmfdqmlkhrnnpacpakgfytydafiaaaksfpsfgttgstdvrkreiaaf
lgqtshettggwpsapdgpyawgycflkernpssnycapsprypcapgksyygrgpiqls
wnynygpcgealrvnllgnpdlvatdrvisfktalwfwmtpqapkpschdvitgrwqpsa
adtaagrlpgygvitniingglecgkgpnpqvadrigffrrycgilgvgtgnnldcynqr
pfg

SCOPe Domain Coordinates for d3cqlb_:

Click to download the PDB-style file with coordinates for d3cqlb_.
(The format of our PDB-style files is described here.)

Timeline for d3cqlb_: