Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Neurocalcin [47539] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47540] (1 PDB entry) |
Domain d1bjfa_: 1bjf A: [17331] complexed with ca |
PDB Entry: 1bjf (more details), 2.4 Å
SCOPe Domain Sequences for d1bjfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} nsklrpevmqdllestdfteheiqewykgflrdcpsghlsmeefkkiygnffpygdaskf aehvfrtfdangdgtidfrefiialsvtsrgkleqklkwafsmydldgngyiskaemlei vqaiykmvssvmkmpedestpekrtekifrqmdtnrdgklsleefirgaksdpsivrllq c
Timeline for d1bjfa_: