SCOPe 2.08: Domain d3cina1: 3cin A:1-209,A:317-381

Lineage for d3cina1 (3cin A:1-209,A:317-381)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Hypothetical protein TM1419 [102161] (1 species)
   myo-inositol 1-phosphate synthase-related protein

7. Species Thermotoga maritima [TaxId:2336] [102162] (2 PDB entries)

8. Domain d3cina1: 3cin A:1-209,A:317-381 [173250]
   Other proteins in same PDB: d3cina2, d3cina3
   structural genomics
   complexed with cl, mg, nad

Details for d3cina1

PDB Entry: 3cin, 1.7 Å

PDB Description: crystal structure of a myo-inositol-1-phosphate synthase-related protein (tm_1419) from thermotoga maritima msb8 at 1.70 a resolution

PDB Compounds: (A:) Myo-inositol-1-phosphate synthase-related protein

SCOPe Domain Sequences for d3cina1:

Sequence; same for both SEQRES and ATOM records:

>d3cina1 c.2.1.3 (A:1-209,A:317-381) Hypothetical protein TM1419 {Thermotoga maritima [TaxId: 2336]}
mvkvlilgqgyvastfvagleklrkgeiepygvplarelpigfedikivgsydvdrakig
kklsevvkqywndvdsltsdpeirkgvhlgsvrnlpieaegledsmtlkeavdtlvkewt
eldpdvivntctteafvpfgnkedllkaienndkerltatqvyayaaalyankrggaafv
nviptfiandpafvelakennlvvfgddgXspalggllvdlvrlgkialdrkefgtvypv
nafymknpgpaeeknipriiayekmriwaglkpkw

Timeline for d3cina1:

• d3cina1 first appeared in SCOPe 2.01
  
• d3cina1 appears in SCOPe 2.07