Lineage for d1dflz_ (1dfl Z:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3377Protein Myosin Regulatory Chain [47527] (2 species)
  7. 3378Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (5 PDB entries)
  8. 3384Domain d1dflz_: 1dfl Z: [17322]
    Other proteins in same PDB: d1dfla1, d1dfla2, d1dflb1, d1dflb2, d1dflw_, d1dfly_

Details for d1dflz_

PDB Entry: 1dfl (more details), 4.2 Å

PDB Description: scallop myosin s1 complexed with mgadp:vanadate-transition state

SCOP Domain Sequences for d1dflz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dflz_ a.39.1.5 (Z:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians)}
sqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeksl
pfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedvd
eiikltdlqedlegnvkyedfvkkvmagpyp

SCOP Domain Coordinates for d1dflz_:

Click to download the PDB-style file with coordinates for d1dflz_.
(The format of our PDB-style files is described here.)

Timeline for d1dflz_: