SCOPe 2.05: Domain d3cfya_: 3cfy A:

Lineage for d3cfya_ (3cfy A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (59 species)
   not a true protein

7. Species Vibrio parahaemolyticus [TaxId:223926] [188373] (1 PDB entry)

8. Domain d3cfya_: 3cfy A: [173217]
   automated match to d1peyc_

Details for d3cfya_

PDB Entry: 3cfy, 2.5 Å

PDB Description: crystal structure of signal receiver domain of putative luxo repressor protein from vibrio parahaemolyticus

PDB Compounds: (A:) Putative LuxO repressor protein

SCOPe Domain Sequences for d3cfya_:

Sequence; same for both SEQRES and ATOM records:

>d3cfya_ c.23.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 223926]}
lrprvllvedstslailykqyvkdepydifhvetgrdaiqfierskpqliildlklpdms
gedvldwinqndiptsviiatahgsvdlavnliqkgaedflekpinadrlktsvalhlkr
akledlvegh

Timeline for d3cfya_:

• d3cfya_ first appeared in SCOPe 2.01
  
• d3cfya_ appears in SCOPe 2.04
  
• d3cfya_ is called d3cfya1 in SCOPe 2.06
  
• d3cfya_ appears in the current release, SCOPe 2.08, called d3cfya1