SCOP 1.75: Domain d1scmc_: 1scm C:

Lineage for d1scmc_ (1scm C:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Regulatory Chain [47527] (2 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (13 PDB entries)
   Uniprot P07291

8. Domain d1scmc_: 1scm C: [17319]
   Other proteins in same PDB: d1scmb_
   complexed with ca

Details for d1scmc_

PDB Entry: 1scm, 2.8 Å

PDB Description: structure of the regulatory domain of scallop myosin at 2.8 angstroms resolution

PDB Compounds: (C:) myosin essential light chain

SCOP Domain Sequences for d1scmc_:

Sequence; same for both SEQRES and ATOM records:

>d1scmc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
sqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeksl
pfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedvd
eiikltdlqedlegnvkyedfvkkvmagp

Timeline for d1scmc_:

• d1scmc_ first appeared (with stable ids) in SCOP 1.55
  
• d1scmc_ appears in SCOP 1.73
  
• d1scmc_ appears in SCOPe 2.01
  
• d1scmc_ appears in the current release, SCOPe 2.08