Lineage for d3cdyb_ (3cdy B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931708Species Human (Homo sapiens) [TaxId:9606] [188740] (24 PDB entries)
  8. 931758Domain d3cdyb_: 3cdy B: [173171]
    automated match to d1b0wa_

Details for d3cdyb_

PDB Entry: 3cdy (more details), 2.43 Å

PDB Description: AL-09 H87Y, immunoglobulin light chain variable domain
PDB Compounds: (B:) immunoglobulin light chain

SCOPe Domain Sequences for d3cdyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cdyb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgvp
srfsgsgsgteftftisslqpedlatyycqqydnlpytfgqgtkleik

SCOPe Domain Coordinates for d3cdyb_:

Click to download the PDB-style file with coordinates for d3cdyb_.
(The format of our PDB-style files is described here.)

Timeline for d3cdyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cdya_