Lineage for d1wdcc_ (1wdc C:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Myosin Regulatory Chain [47527] (2 species) Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47528] (5 PDB entries) 
Domain d1wdcc_: 1wdc C: [17317]
Other proteins in same PDB: d1wdcb_
Details for d1wdcc_
PDB Entry: 1wdc (more details), 2 Å
PDB Description: scallop myosin regulatory domain
SCOP Domain Sequences for d1wdcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians)}
lsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgeks
lpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsdedv
deiikltdlqedlegnvkyedfvkkvmagpyp
SCOP Domain Coordinates for d1wdcc_:
Click to download the PDB-style file with coordinates for d1wdcc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1wdcc_:
- d1wdcc_ appears in SCOP 1.57
- d1wdcc_ appears in the current release, SCOPe 2.08
View in 3D
