SCOPe 2.05: Domain d3cdpb_: 3cdp B:

Lineage for d3cdpb_ (3cdp B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)

8. Domain d3cdpb_: 3cdp B: [173161]
   automated match to d1nyxa_
   protein/DNA complex; complexed with yrg

Details for d3cdpb_

PDB Entry: 3cdp, 2.8 Å

PDB Description: Crystal structure of PPAR-gamma LBD complexed with a partial agonist, analogue of clofibric acid

PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3cdpb_:

Sequence; same for both SEQRES and ATOM records:

>d3cdpb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Timeline for d3cdpb_:

• d3cdpb_ first appeared in SCOPe 2.01
  
• d3cdpb_ appears in SCOPe 2.04
  
• d3cdpb_ appears in SCOPe 2.06
  
• d3cdpb_ appears in the current release, SCOPe 2.08