Lineage for d3cdpa_ (3cdp A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502431Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1502432Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1502433Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1503273Protein automated matches [190059] (14 species)
    not a true protein
  7. 1503295Species Human (Homo sapiens) [TaxId:9606] [187214] (126 PDB entries)
  8. 1503509Domain d3cdpa_: 3cdp A: [173160]
    automated match to d1nyxa_
    protein/DNA complex; complexed with yrg

Details for d3cdpa_

PDB Entry: 3cdp (more details), 2.8 Å

PDB Description: Crystal structure of PPAR-gamma LBD complexed with a partial agonist, analogue of clofibric acid
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3cdpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cdpa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d3cdpa_:

Click to download the PDB-style file with coordinates for d3cdpa_.
(The format of our PDB-style files is described here.)

Timeline for d3cdpa_: