Lineage for d1br4h_ (1br4 H:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 213166Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 213167Superfamily a.39.1: EF-hand [47473] (9 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 213324Family a.39.1.5: Calmodulin-like [47502] (17 proteins)
    Duplication: made with two pairs of EF-hands
  6. 213436Protein Myosin Essential Chain [47524] (2 species)
  7. 213449Species Chicken (Gallus gallus) [TaxId:9031] [47526] (3 PDB entries)
  8. 213458Domain d1br4h_: 1br4 H: [17316]
    Other proteins in same PDB: d1br4a1, d1br4a2, d1br4c1, d1br4c2, d1br4e1, d1br4e2, d1br4g1, d1br4g2
    complexed with adp, bef, mg

Details for d1br4h_

PDB Entry: 1br4 (more details), 3.62 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site

SCOP Domain Sequences for d1br4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br4h_ a.39.1.5 (H:) Myosin Essential Chain {Chicken (Gallus gallus)}
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg

SCOP Domain Coordinates for d1br4h_:

Click to download the PDB-style file with coordinates for d1br4h_.
(The format of our PDB-style files is described here.)

Timeline for d1br4h_: