Class a: All alpha proteins [46456] (171 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (9 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (17 proteins) Duplication: made with two pairs of EF-hands |
Protein Myosin Essential Chain [47524] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47526] (3 PDB entries) |
Domain d1br4h_: 1br4 H: [17316] Other proteins in same PDB: d1br4a1, d1br4a2, d1br4c1, d1br4c2, d1br4e1, d1br4e2, d1br4g1, d1br4g2 complexed with adp, bef, mg |
PDB Entry: 1br4 (more details), 3.62 Å
SCOP Domain Sequences for d1br4h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1br4h_ a.39.1.5 (H:) Myosin Essential Chain {Chicken (Gallus gallus)} fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee eveqlvaghedsngcinyeelvrmvlsg
Timeline for d1br4h_: