SCOPe 2.04: Domain d3cdcb_: 3cdc B:

Lineage for d3cdcb_ (3cdc B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries)

8. Domain d3cdcb_: 3cdc B: [173146]
   automated match to d1b0wa_

Details for d3cdcb_

PDB Entry: 3cdc, 1.53 Å

PDB Description: kI O18/O8 N34I/Y87H immunoglobulin light chain variable domain

PDB Compounds: (B:) Light Chain Amyloidogenic

SCOPe Domain Sequences for d3cdcb_:

Sequence; same for both SEQRES and ATOM records:

>d3cdcb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stdiqmtqspsslsasvgdrvtitcqasqdisnyliwyqqkpgkapklliydasnletgv
psrfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleik

Timeline for d3cdcb_:

• d3cdcb_ first appeared in SCOPe 2.01
  
• d3cdcb_ appears in SCOPe 2.03
  
• d3cdcb_ appears in SCOPe 2.05
  
• d3cdcb_ appears in the current release, SCOPe 2.08