Lineage for d3ccna_ (3ccn A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1220850Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1220851Species Human (Homo sapiens) [TaxId:9606] [103301] (22 PDB entries)
  8. 1220859Domain d3ccna_: 3ccn A: [173141]
    automated match to d1r0pa_
    complexed with lkg

Details for d3ccna_

PDB Entry: 3ccn (more details), 1.9 Å

PDB Description: X-ray structure of c-Met with triazolopyridazine inhibitor.
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3ccna_:

Sequence, based on SEQRES records: (download)

>d3ccna_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavkslnr
itdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirneth
nptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkey
ysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditv
yllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

Sequence, based on observed residues (ATOM records): (download)

>d3ccna_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlkihcavkslnrevsqfl
tegiimkdfshpnvlsllgiclplvvlpymkhgdlrnfirnethnptvkdligfglqvak
gmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhktgaklpvkwma
leslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdp
lyevmlkcwhpkaemrpsfselvsrisaifstfig

SCOPe Domain Coordinates for d3ccna_:

Click to download the PDB-style file with coordinates for d3ccna_.
(The format of our PDB-style files is described here.)

Timeline for d3ccna_: