SCOPe 2.04: Domain d3cchk_: 3cch K:

Lineage for d3cchk_ (3cch K:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries)
   Uniprot P01887

8. Domain d3cchk_: 3cch K: [173138]
   automated match to d1biib_
   complexed with gol, so4

Details for d3cchk_

PDB Entry: 3cch, 2.6 Å

PDB Description: H-2Db complex with murine gp100

PDB Compounds: (K:) Beta-2-microglobulin

SCOPe Domain Sequences for d3cchk_:

Sequence; same for both SEQRES and ATOM records:

>d3cchk_ b.1.1.2 (K:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d3cchk_:

• d3cchk_ first appeared in SCOPe 2.01
  
• d3cchk_ appears in SCOPe 2.03
  
• d3cchk_ appears in SCOPe 2.05
  
• d3cchk_ appears in the current release, SCOPe 2.08