Lineage for d1br4b_ (1br4 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Myosin Essential Chain [47524] (2 species) 
Species Chicken (Gallus gallus) [TaxId:9031] [47526] (3 PDB entries) 
Domain d1br4b_: 1br4 B: [17313]
Other proteins in same PDB: d1br4a1, d1br4a2, d1br4c1, d1br4c2, d1br4e1, d1br4e2, d1br4g1, d1br4g2
Details for d1br4b_
PDB Entry: 1br4 (more details), 3.62 Å
PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site
SCOP Domain Sequences for d1br4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1br4b_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus)}
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg
SCOP Domain Coordinates for d1br4b_:
Click to download the PDB-style file with coordinates for d1br4b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1br4b_:
- d1br4b_ appears in SCOP 1.57
- d1br4b_ appears in the current release, SCOPe 2.08
View in 3D
