Lineage for d3cbba_ (3cbb A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035613Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
    duplication: two zinc-binding motifs
  6. 3035704Protein automated matches [190314] (3 species)
    not a true protein
  7. 3035708Species Human (Homo sapiens) [TaxId:9606] [188623] (6 PDB entries)
  8. 3035709Domain d3cbba_: 3cbb A: [173117]
    automated match to d1r0oa_
    protein/DNA complex; complexed with zn

Details for d3cbba_

PDB Entry: 3cbb (more details), 2 Å

PDB Description: crystal structure of hepatocyte nuclear factor 4alpha in complex with dna: diabetes gene product
PDB Compounds: (A:) Hepatocyte Nuclear Factor 4-alpha, DNA binding domain

SCOPe Domain Sequences for d3cbba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cbba_ g.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alcaicgdratgkhygasscdgckgffrrsvrknhmyscrfsrqcvvdkdkrnqcrycrl
kkcfragmkkeavqne

SCOPe Domain Coordinates for d3cbba_:

Click to download the PDB-style file with coordinates for d3cbba_.
(The format of our PDB-style files is described here.)

Timeline for d3cbba_: