SCOPe 2.01: Domain d3cb7a_: 3cb7 A:

Lineage for d3cb7a_ (3cb7 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.0: automated matches [191411] (1 protein)
   not a true family

6. Protein automated matches [190563] (6 species)
   not a true protein

7. Species Musca domestica [TaxId:7370] [188790] (1 PDB entry)

8. Domain d3cb7a_: 3cb7 A: [173114]
   automated match to d1gd6a_
   complexed with acy, gol, ipa

Details for d3cb7a_

PDB Entry: 3cb7, 1.9 Å

PDB Description: The crystallographic structure of the digestive lysozyme 2 from Musca domestica at 1.9 Ang.

PDB Compounds: (A:) Lys-rich lysozyme 2

SCOPe Domain Sequences for d3cb7a_:

Sequence; same for both SEQRES and ATOM records:

>d3cb7a_ d.2.1.0 (A:) automated matches {Musca domestica}
eaeaktftrcslaremyklgvpknqlarwtciaehessyntkavgslnsngsrdygifqi
nnyywcsppsgafsydeckikcedflvdsiepavkcaqlvlkqqgwtawstwkycdgtlp
siddcf

Timeline for d3cb7a_:

• d3cb7a_ is new in SCOPe 2.01-stable
  
• d3cb7a_ appears in SCOPe 2.02
  
• d3cb7a_ appears in the current release, SCOPe 2.08, called d3cb7a1