Lineage for d3cb7a_ (3cb7 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014821Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1014822Protein automated matches [190563] (6 species)
    not a true protein
  7. 1014832Species Musca domestica [TaxId:7370] [188790] (1 PDB entry)
  8. 1014833Domain d3cb7a_: 3cb7 A: [173114]
    automated match to d1gd6a_
    complexed with acy, gol, ipa

Details for d3cb7a_

PDB Entry: 3cb7 (more details), 1.9 Å

PDB Description: The crystallographic structure of the digestive lysozyme 2 from Musca domestica at 1.9 Ang.
PDB Compounds: (A:) Lys-rich lysozyme 2

SCOPe Domain Sequences for d3cb7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cb7a_ d.2.1.0 (A:) automated matches {Musca domestica}
eaeaktftrcslaremyklgvpknqlarwtciaehessyntkavgslnsngsrdygifqi
nnyywcsppsgafsydeckikcedflvdsiepavkcaqlvlkqqgwtawstwkycdgtlp
siddcf

SCOPe Domain Coordinates for d3cb7a_:

Click to download the PDB-style file with coordinates for d3cb7a_.
(The format of our PDB-style files is described here.)

Timeline for d3cb7a_: