Lineage for d3cb0b_ (3cb0 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794356Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2794357Protein automated matches [190439] (22 species)
    not a true protein
  7. 2794370Species Brucella melitensis [TaxId:29459] [188364] (1 PDB entry)
  8. 2794372Domain d3cb0b_: 3cb0 B: [173111]
    automated match to d1rz0a_
    complexed with fmn

Details for d3cb0b_

PDB Entry: 3cb0 (more details), 1.6 Å

PDB Description: cobr
PDB Compounds: (B:) 4-hydroxyphenylacetate 3-monooxygenase

SCOPe Domain Sequences for d3cb0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cb0b_ b.45.1.0 (B:) automated matches {Brucella melitensis [TaxId: 29459]}
vstveskayrdamshyagavqivttagaagrrgltltaacsvsdnpptiliclqkiheen
rifiengvfaintlagphqqladafsgrigltqderfelaaweilatgapvlkgalaafd
crvvsvqdhsthhvlfgevvglsshaeeealiylnrryhklel

SCOPe Domain Coordinates for d3cb0b_:

Click to download the PDB-style file with coordinates for d3cb0b_.
(The format of our PDB-style files is described here.)

Timeline for d3cb0b_: