Class b: All beta proteins [48724] (176 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.0: automated matches [191552] (1 protein) not a true family |
Protein automated matches [190954] (9 species) not a true protein |
Species Trichoderma reesei [TaxId:51453] [188563] (1 PDB entry) |
Domain d3c9xa_: 3c9x A: [173096] automated match to d1e5oe_ complexed with gol |
PDB Entry: 3c9x (more details), 1.7 Å
SCOPe Domain Sequences for d3c9xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c9xa_ b.50.1.0 (A:) automated matches {Trichoderma reesei [TaxId: 51453]} etgsapnhpsdsadseyitsvsigtpaqvlpldfdtgssdlwvfssetpkssatghaiyt psksstskkvsgaswsisygdgssssgdvytdkvtiggfsvntqgvesatrvstefvqdt visglvglafdsgnqvrphpqktwfsnaasslaeplftadlrhgqngsynfgyidtsvak gpvaytpvdnsqgfweftasgysvgggklnrnsidgiadtgttllllddnvvdayyanvq saqydnqqegvvfdcdedlpsfsfgvgsstitipgdllnltpleegsstcfgglqsssgi ginifgdvalkaalvvfdlgnerlgwaqk
Timeline for d3c9xa_: