Lineage for d1dflw_ (1dfl W:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1734192Protein Myosin Essential Chain [47524] (3 species)
  7. 1734193Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries)
    Uniprot P13543
  8. 1734205Domain d1dflw_: 1dfl W: [17306]
    Other proteins in same PDB: d1dfla1, d1dfla2, d1dflb1, d1dflb2, d1dflx_, d1dflz_
    complexed with adp, ca, mg, vo4

Details for d1dflw_

PDB Entry: 1dfl (more details), 4.2 Å

PDB Description: scallop myosin s1 complexed with mgadp:vanadate-transition state
PDB Compounds: (W:) myosin head

SCOPe Domain Sequences for d1dflw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dflw_ a.39.1.5 (W:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
kqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmfls
ifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkeapv
eggkfdyvkftamikg

SCOPe Domain Coordinates for d1dflw_:

Click to download the PDB-style file with coordinates for d1dflw_.
(The format of our PDB-style files is described here.)

Timeline for d1dflw_: