Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Myosin Essential Chain [47524] (3 species) |
Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries) Uniprot P13543 |
Domain d1dflw_: 1dfl W: [17306] Other proteins in same PDB: d1dfla1, d1dfla2, d1dflb1, d1dflb2, d1dflx_, d1dflz_ complexed with adp, ca, mg, vo4 |
PDB Entry: 1dfl (more details), 4.2 Å
SCOPe Domain Sequences for d1dflw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dflw_ a.39.1.5 (W:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} kqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmfls ifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkeapv eggkfdyvkftamikg
Timeline for d1dflw_: