Lineage for d3c4fa_ (3c4f A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1434615Protein Fibroblast growth factor receptor 1 [56158] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 1434616Species Human (Homo sapiens) [TaxId:9606] [56159] (14 PDB entries)
  8. 1434623Domain d3c4fa_: 3c4f A: [173038]
    automated match to d1agwa_
    complexed with c4f

Details for d3c4fa_

PDB Entry: 3c4f (more details), 2.07 Å

PDB Description: fgfr tyrosine kinase domain in complex with 3-(3-methoxybenzyl)-7-azaindole
PDB Compounds: (A:) Basic fibroblast growth factor receptor 1

SCOPe Domain Sequences for d3c4fa_:

Sequence, based on SEQRES records: (download)

>d3c4fa_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppgley
cynpshnpeeqlsskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfg
lardihhidyykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypg
vpveelfkllkeghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsn
qe

Sequence, based on observed residues (ATOM records): (download)

>d3c4fa_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]}
elpedprwelprdrlvlgkplgegafgqvvlaeaigldkdkpnrvtkvavkmlksdatek
dlsdlisememmkmigkhkniinllgactqdgplyviveyaskgnlreylqarrppeeql
sskdlvscayqvargmeylaskkcihrdlaarnvlvtednvmkiadfglardihhidyyk
kttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllke
ghrmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe

SCOPe Domain Coordinates for d3c4fa_:

Click to download the PDB-style file with coordinates for d3c4fa_.
(The format of our PDB-style files is described here.)

Timeline for d3c4fa_: