SCOPe 2.03: Domain d3c4ed_: 3c4e D:

Lineage for d3c4ed_ (3c4e D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (59 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d3c4ed_: 3c4e D: [173037]
   automated match to d1xqza_
   complexed with c4e, imd

Details for d3c4ed_

PDB Entry: 3c4e, 1.98 Å

PDB Description: Pim-1 Kinase Domain in Complex with 3-aminophenyl-7-azaindole

PDB Compounds: (D:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d3c4ed_:

Sequence; same for both SEQRES and ATOM records:

>d3c4ed_ d.144.1.7 (D:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d3c4ed_:

• d3c4ed_ first appeared in SCOPe 2.01
  
• d3c4ed_ appears in SCOPe 2.02
  
• d3c4ed_ appears in SCOPe 2.04
  
• d3c4ed_ appears in the current release, SCOPe 2.08