Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (58 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [188756] (6 PDB entries) |
Domain d3c41k_: 3c41 K: [173033] automated match to d1b0ua_ complexed with anp, mg |
PDB Entry: 3c41 (more details), 2.25 Å
SCOPe Domain Sequences for d3c41k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c41k_ c.37.1.0 (K:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk vf
Timeline for d3c41k_: