SCOPe 2.01: Domain d3c41k_: 3c41 K:

Lineage for d3c41k_ (3c41 K:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (20 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [188756] (1 PDB entry)

8. Domain d3c41k_: 3c41 K: [173033]
   automated match to d1b0ua_
   complexed with anp, mg

Details for d3c41k_

PDB Entry: 3c41, 2.25 Å

PDB Description: abc protein artp in complex with amp-pnp/mg2+

PDB Compounds: (K:) Amino acid ABC transporter (ArtP)

SCOPe Domain Sequences for d3c41k_:

Sequence; same for both SEQRES and ATOM records:

>d3c41k_ c.37.1.0 (K:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
lqmidvhqlkksfgslevlkginvhiregevvvvigpsgsgkstflrclnlledfdegei
iidginlkakdtnlnkvreevgmvfqrfnlfphmtvlnnitlapmkvrkwprekaeakam
elldkvglkdkahaypdslsggqaqrvaiaralamepkimlfdeptsaldpemvgevlsv
mkqlanegmtmvvvthemgfarevgdrvlfmdggyiieegkpedlfdrpqhertkaflsk
vf

Timeline for d3c41k_:

• d3c41k_ is new in SCOPe 2.01-stable
  
• d3c41k_ appears in SCOPe 2.02
  
• d3c41k_ appears in the current release, SCOPe 2.08