SCOPe 2.04: Domain d3c3xa_: 3c3x A:

Lineage for d3c3xa_ (3c3x A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Ocimum basilicum [TaxId:39350] [188465] (7 PDB entries)

8. Domain d3c3xa_: 3c3x A: [173028]
   automated match to d1qyca_
   complexed with nap

Details for d3c3xa_

PDB Entry: 3c3x, 2.15 Å

PDB Description: the multiple phenylpropene synthases in both clarkia breweri and petunia hybrida represent two distinct lineages

PDB Compounds: (A:) Eugenol synthase 1

SCOPe Domain Sequences for d3c3xa_:

Sequence; same for both SEQRES and ATOM records:

>d3c3xa_ c.2.1.0 (A:) automated matches {Ocimum basilicum [TaxId: 39350]}
gmkskilifggtgyignhmvkgslklghptyvftrpnsskttlldefqslgaiivkgeld
eheklvelmkkvdvvisalavpqyldqfkileaikvagnikrflpsdfgveedrinalpp
fealierkrmirraieeanipytyvsancfasyfinyllrpydpkdeitvygtgeakfam
nyeqdiglytikvatdpralnrvviyrpstniitqlelisrwekkigkkfkkihvpeeei
valtkelpepenipiailhclfidgatmsydfkendveastlypelkfttidelldifvh
dppppasaaf

Timeline for d3c3xa_:

• d3c3xa_ first appeared in SCOPe 2.01
  
• d3c3xa_ appears in SCOPe 2.03
  
• d3c3xa_ appears in SCOPe 2.05
  
• d3c3xa_ appears in the current release, SCOPe 2.08