Lineage for d3c3pb_ (3c3p B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146741Species Geobacter sulfurreducens [TaxId:243231] [188338] (1 PDB entry)
  8. 2146743Domain d3c3pb_: 3c3p B: [173026]
    Other proteins in same PDB: d3c3pa2
    automated match to d2avda1
    complexed with cl, edo, peg

Details for d3c3pb_

PDB Entry: 3c3p (more details), 1.9 Å

PDB Description: crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution
PDB Compounds: (B:) Methyltransferase

SCOPe Domain Sequences for d3c3pb_:

Sequence, based on SEQRES records: (download)

>d3c3pb_ c.66.1.0 (B:) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
pivdsrigayldgllpeadpvvaameqiarernipivdrqtgrllyllarikqpqlvvvp
gdglgcaswwfaraisissrvvmidpdrdnveharrmlhdnglidrvelqvgdplgiaag
qrdidilfmdcdvfngadvlermnrclaknalliavnalrrgsvaeshedpetaalrefn
hhlsrrrdffttivpvgngvllgyrl

Sequence, based on observed residues (ATOM records): (download)

>d3c3pb_ c.66.1.0 (B:) automated matches {Geobacter sulfurreducens [TaxId: 243231]}
pivdsrigayldgllpeadpvvaameqiarernipivdrqtgrllyllarikqpqlvvvp
gdglgcaswwfaraisissrvvmidpdrdnveharrmlhdnglidrvelqvgdplgiaag
qrdidilfmdcdvfngadvlermnrclaknalliavnalrrefnhhlsrrrdffttivpv
gngvllgyrl

SCOPe Domain Coordinates for d3c3pb_:

Click to download the PDB-style file with coordinates for d3c3pb_.
(The format of our PDB-style files is described here.)

Timeline for d3c3pb_: