Lineage for d3c3na_ (3c3n A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828301Protein automated matches [190228] (20 species)
    not a true protein
  7. 2828442Species Trypanosoma cruzi [TaxId:5693] [187324] (7 PDB entries)
  8. 2828455Domain d3c3na_: 3c3n A: [173021]
    automated match to d2b4ga1
    complexed with fmn, gol, so4

Details for d3c3na_

PDB Entry: 3c3n (more details), 2.2 Å

PDB Description: Crystal structure of dihydroorotate dehydrogenase from Trypanosoma cruzi strain Y
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d3c3na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c3na_ c.1.4.1 (A:) automated matches {Trypanosoma cruzi [TaxId: 5693]}
clklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpepryma
vplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqek
gvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaav
lnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrrc
pdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyrt
leefrgrvkti

SCOPe Domain Coordinates for d3c3na_:

Click to download the PDB-style file with coordinates for d3c3na_.
(The format of our PDB-style files is described here.)

Timeline for d3c3na_: