SCOPe 2.06: Domain d1wdcb_: 1wdc B:

Lineage for d1wdcb_ (1wdc B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Myosin Essential Chain [47524] (3 species)

7. Species Bay scallop (Aequipecten irradians) [TaxId:31199] [47525] (13 PDB entries)
   Uniprot P13543

8. Domain d1wdcb_: 1wdc B: [17302]
   Other proteins in same PDB: d1wdcc_
   complexed with ca, mg

Details for d1wdcb_

PDB Entry: 1wdc, 2 Å

PDB Description: scallop myosin regulatory domain

PDB Compounds: (B:) scallop myosin

SCOPe Domain Sequences for d1wdcb_:

Sequence; same for both SEQRES and ATOM records:

>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]}
lpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftm
flsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfke
apveggkfdyvkftamikgsge

Timeline for d1wdcb_:

• d1wdcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1wdcb_ appears in SCOPe 2.05
  
• d1wdcb_ appears in SCOPe 2.07
  
• d1wdcb_ appears in the current release, SCOPe 2.08