SCOPe 2.08: Domain d3c3kb1: 3c3k B:7-277

Lineage for d3c3kb1 (3c3k B:7-277)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Actinobacillus succinogenes [TaxId:339671] [188337] (2 PDB entries)

8. Domain d3c3kb1: 3c3k B:7-277 [173019]
   Other proteins in same PDB: d3c3ka2, d3c3kb2
   automated match to d1sxga_
   complexed with cl, gol

Details for d3c3kb1

PDB Entry: 3c3k, 1.99 Å

PDB Description: crystal structure of an uncharacterized protein from actinobacillus succinogenes

PDB Compounds: (B:) alanine racemase

SCOPe Domain Sequences for d3c3kb1:

Sequence; same for both SEQRES and ATOM records:

>d3c3kb1 c.93.1.0 (B:7-277) automated matches {Actinobacillus succinogenes [TaxId: 339671]}
ktgmllvmvsnianpfcaavvkgiektaekngyrillcntesdlarsrscltllsgkmvd
gvitmdalselpelqniigafpwvqcaeydplstvssvsiddvaaseyvvdqlvksgkkr
ialinhdlayqyaqhresgylnrlkfhgldysrisyaenldymagklatfsllksavkpd
aifaisdvlaagaiqaltesglsipqdvavvgfdgvdisqitvpalttvqqpseqigmka
vsllleqihsdvlaktvhhllpwkfvrrqss

Timeline for d3c3kb1:

• d3c3kb1 first appeared in SCOPe 2.01, called d3c3kb_
  
• d3c3kb1 appears in SCOPe 2.07