Lineage for d1clm__ (1clm -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.5: Calmodulin-like [47502] (15 proteins) Protein Calmodulin [47516] (7 species) Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [47523] (3 PDB entries) 
Domain d1clm__: 1clm - [17301]
Details for d1clm__
PDB Entry: 1clm (more details), 1.8 Å
PDB Description: structure of paramecium tetraurelia calmodulin at 1.8 angstroms resolution
SCOP Domain Sequences for d1clm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clm__ a.39.1.5 (-) Calmodulin {Ciliate (Paramecium tetraurelia)}
lteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddevde
mireadidgdghinyeefvrmmvs
SCOP Domain Coordinates for d1clm__:
Click to download the PDB-style file with coordinates for d1clm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1clm__:
- d1clm__ first appeared (with stable ids) in SCOP 1.55
- d1clm__ appears in SCOP 1.59
- d1clm__ appears in the current release, SCOPe 2.08, called d1clma_
View in 3D