Lineage for d1clm__ (1clm -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3306Protein Calmodulin [47516] (7 species)
  7. 3318Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [47523] (3 PDB entries)
  8. 3321Domain d1clm__: 1clm - [17301]

Details for d1clm__

PDB Entry: 1clm (more details), 1.8 Å

PDB Description: structure of paramecium tetraurelia calmodulin at 1.8 angstroms resolution

SCOP Domain Sequences for d1clm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clm__ a.39.1.5 (-) Calmodulin {Ciliate (Paramecium tetraurelia)}
lteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngti
dfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddevde
mireadidgdghinyeefvrmmvs

SCOP Domain Coordinates for d1clm__:

Click to download the PDB-style file with coordinates for d1clm__.
(The format of our PDB-style files is described here.)

Timeline for d1clm__: