Lineage for d1exra_ (1exr A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) Protein Calmodulin [47516] (7 species) Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [47523] (3 PDB entries) 
Domain d1exra_: 1exr A: [17299]
Details for d1exra_
PDB Entry: 1exr (more details), 1 Å
PDB Description: the 1.0 angstrom crystal structure of ca+2 bound calmodulin
SCOP Domain Sequences for d1exra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia)}
eqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
tidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddev
demireadidgdghinyeefvrmmvs
SCOP Domain Coordinates for d1exra_:
Click to download the PDB-style file with coordinates for d1exra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1exra_:
- d1exra_ appears in SCOP 1.57
- d1exra_ appears in the current release, SCOPe 2.08
View in 3D