Lineage for d2bbna_ (2bbn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996818Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1996875Protein Calmodulin [47516] (12 species)
  7. 1996946Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (13 PDB entries)
  8. 1996963Domain d2bbna_: 2bbn A: [17298]
    complexed with ca

Details for d2bbna_

PDB Entry: 2bbn (more details)

PDB Description: solution structure of a calmodulin-target peptide complex by multidimensional nmr
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2bbna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbna_ a.39.1.5 (A:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
vdemireadidgdgqvnyeefvtmmtsk

SCOPe Domain Coordinates for d2bbna_:

Click to download the PDB-style file with coordinates for d2bbna_.
(The format of our PDB-style files is described here.)

Timeline for d2bbna_: