Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (4 species) not a true protein |
Species Mung bean (Vigna radiata) [TaxId:157791] [187717] (2 PDB entries) |
Domain d3c0vc_: 3c0v C: [172979] automated match to d1fm4a_ complexed with epe, na, tbr, zea |
PDB Entry: 3c0v (more details), 1.8 Å
SCOPe Domain Sequences for d3c0vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c0vc_ d.129.3.0 (C:) automated matches {Mung bean (Vigna radiata) [TaxId: 157791]} mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy dhdsdieekvtptktsqstlmylrrleryls
Timeline for d3c0vc_: