Lineage for d3c0va_ (3c0v A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668833Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1669085Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1669378Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1669379Protein automated matches [190218] (19 species)
    not a true protein
  7. 1669481Species Mung bean (Vigna radiata) [TaxId:157791] [187717] (3 PDB entries)
  8. 1669487Domain d3c0va_: 3c0v A: [172977]
    automated match to d1fm4a_
    complexed with epe, na, tbr, zea

Details for d3c0va_

PDB Entry: 3c0v (more details), 1.8 Å

PDB Description: crystal structure of cytokinin-specific binding protein in complex with cytokinin and ta6br12
PDB Compounds: (A:) cytokinin-specific binding protein

SCOPe Domain Sequences for d3c0va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c0va_ d.129.3.0 (A:) automated matches {Mung bean (Vigna radiata) [TaxId: 157791]}
mvkefntqtelsvrlealwavlskdfitvvpkvlphivkdvqliegdggvgtilifnflp
evspsyqreeitefdessheiglqvieggylsqglsyykttfklseieedktlvnvkisy
dhdsdieekvtptktsqstlmylrrleryls

SCOPe Domain Coordinates for d3c0va_:

Click to download the PDB-style file with coordinates for d3c0va_.
(The format of our PDB-style files is described here.)

Timeline for d3c0va_: