SCOPe 2.01: Domain d2bbma_: 2bbm A:

Lineage for d2bbma_ (2bbm A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (11 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [47522] (9 PDB entries)

8. Domain d2bbma_: 2bbm A: [17297]
   complexed with ca

Details for d2bbma_

PDB Entry: 2bbm

PDB Description: solution structure of a calmodulin-target peptide complex by multidimensional nmr

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2bbma_:

Sequence; same for both SEQRES and ATOM records:

>d2bbma_ a.39.1.5 (A:) Calmodulin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
vdemireadidgdgqvnyeefvtmmtsk

Timeline for d2bbma_:

• d2bbma_ first appeared (with stable ids) in SCOP 1.55
  
• d2bbma_ appears in SCOP 1.75
  
• d2bbma_ appears in SCOPe 2.02
  
• d2bbma_ appears in the current release, SCOPe 2.08