Lineage for d2bbma_ (2bbm A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3306Protein Calmodulin [47516] (7 species)
  7. 3344Species Drosophila melanogaster [TaxId:7227] [47522] (3 PDB entries)
  8. 3346Domain d2bbma_: 2bbm A: [17297]

Details for d2bbma_

PDB Entry: 2bbm (more details)

PDB Description: solution structure of a calmodulin-target peptide complex by multidimensional nmr

SCOP Domain Sequences for d2bbma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbma_ a.39.1.5 (A:) Calmodulin {Drosophila melanogaster}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
vdemireadidgdgqvnyeefvtmmtsk

SCOP Domain Coordinates for d2bbma_:

Click to download the PDB-style file with coordinates for d2bbma_.
(The format of our PDB-style files is described here.)

Timeline for d2bbma_: