Lineage for d4cln__ (4cln -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) Protein Calmodulin [47516] (7 species) 
Species Drosophila melanogaster [TaxId:7227] [47522] (3 PDB entries) 
Domain d4cln__: 4cln - [17296]
Details for d4cln__
PDB Entry: 4cln (more details), 2.2 Å
PDB Description: structure of a recombinant calmodulin from drosophila melanogaster refined at 2.2-angstroms resolution
SCOP Domain Sequences for d4cln__:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cln__ a.39.1.5 (-) Calmodulin {Drosophila melanogaster}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdtdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdee
vdemireadidgdgqvnyeefvtmmtsk
SCOP Domain Coordinates for d4cln__:
Click to download the PDB-style file with coordinates for d4cln__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4cln__:
- d4cln__ appears in SCOP 1.57
- d4cln__ appears in the current release, SCOPe 2.08, called d4clna_
View in 3D