Lineage for d3bz1o_ (3bz1 O:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627487Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2627529Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 2627561Protein automated matches [191004] (2 species)
    not a true protein
  7. 2627568Species Thermosynechococcus elongatus [TaxId:32046] [188749] (2 PDB entries)
  8. 2627570Domain d3bz1o_: 3bz1 O: [172950]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1o_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d3bz1o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1o_ f.4.1.4 (O:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d3bz1o_:

Click to download the PDB-style file with coordinates for d3bz1o_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1o_: