Lineage for d3bz1l_ (3bz1 L:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254762Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 2254763Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 2254783Protein automated matches [191003] (2 species)
    not a true protein
  7. 2254786Species Thermosynechococcus elongatus [TaxId:32046] [188748] (2 PDB entries)
  8. 2254788Domain d3bz1l_: 3bz1 L: [172948]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1l_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d3bz1l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1l_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
mepnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d3bz1l_:

Click to download the PDB-style file with coordinates for d3bz1l_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1l_: