Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) automatically mapped to Pfam PF02419 |
Family f.23.31.1: PsbL-like [161018] (2 proteins) Pfam PF02419 |
Protein automated matches [191003] (3 species) not a true protein |
Species Thermosynechococcus elongatus [TaxId:32046] [188748] (2 PDB entries) |
Domain d3bz1l_: 3bz1 L: [172948] Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1l_ f.23.31.1 (L:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} mepnpnrqpvelnrtslylglllilvlallfssyffn
Timeline for d3bz1l_: