Lineage for d3bz1f_ (3bz1 F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2632073Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) (S)
  5. 2632074Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
    Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
  6. 2632127Protein automated matches [191000] (6 species)
    not a true protein
  7. 2632147Species Thermosynechococcus elongatus [TaxId:32046] [188745] (2 PDB entries)
  8. 2632151Domain d3bz1f_: 3bz1 F: [172945]
    Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd

Details for d3bz1f_

PDB Entry: 3bz1 (more details), 2.9 Å

PDB Description: Crystal Structure of cyanobacterial Photosystem II (part 1 of 2). This file contains first monomer of PSII dimer
PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d3bz1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bz1f_ f.23.38.1 (F:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
vsypiftvrwvavhtlavptifflgaiaamqfiqr

SCOPe Domain Coordinates for d3bz1f_:

Click to download the PDB-style file with coordinates for d3bz1f_.
(The format of our PDB-style files is described here.)

Timeline for d3bz1f_: