| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
| Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
| Protein automated matches [191000] (6 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:32046] [188745] (2 PDB entries) |
| Domain d3bz1e_: 3bz1 E: [172944] Other proteins in same PDB: d3bz1a_, d3bz1b_, d3bz1c_, d3bz1d_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1e_ f.23.38.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]}
gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs
iplvtdrfeakqqvetfleqlk
Timeline for d3bz1e_: